• Complex
  • Title
  • Keyword
  • Abstract
  • Scholars
  • Journal
  • ISSN
  • Conference
成果搜索

author:

Wei, L. (Wei, L..) [1] | Yang, J. (Yang, J..) [2] | He, X. (He, X..) [3] | Mo, G. (Mo, G..) [4] | Hong, J. (Hong, J..) [5] | Yan, X. (Yan, X..) [6] | Lin, D. (Lin, D..) [7] | Lai, R. (Lai, R..) [8]

Indexed by:

Scopus

Abstract:

Antimicrobial peptides (AMPs) play pivotal roles in the innate defense of vertebrates. A novel AMP (cathelicidin-PY) has been identified from the skin secretions of the frog Paa yunnanensis. Cathelicidin-PY has an amino acid sequence of RKCNFLCKLKEKLRTVITSHIDKVLRPQG. Nuclear magnetic resonance (NMR) spectroscopy analysis revealed that cathelicidin-PY adopts a tertiary structure with a mostly positively charged surface containing a helix (Thr15-Ser19). It possesses strong antimicrobial activity, low hemolytic activity, low cytotoxicity against RAW 264.7 cells, and strong anti-inflammatory activity. The action of antimicrobial activity of cathelicidin-PY is through the destruction of the cell membrane. Moreover, cathelicidin-PY exerts anti-inflammatory activity by inhibiting the production of nitric oxide (NO) and inflammatory cytokines such as tumor necrosis factor (TNF-α), interleukin-6 (IL-6), and monocyte chemoattractant protein-1 (MCP-1). Cathelicidin-PY inhibits the activation of Toll-like receptor 4 (TLR4) inflammatory response pathways induced by lipopolysaccharide (LPS). The NMR titration experiments indicated that cathelicidin-PY can bind to LPS. In conclusion, we have identified a novel potent peptide antibiotic with both antimicrobial and anti-inflammatory activities and laid the groundwork for future research and development. © 2013 American Chemical Society.

Keyword:

Community:

  • [ 1 ] [Wei, L.]Life Sciences College, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China
  • [ 2 ] [Yang, J.]Department of Chemistry, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005, Fujian, China
  • [ 3 ] [He, X.]Life Sciences College, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China
  • [ 4 ] [Mo, G.]Life Sciences College, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China
  • [ 5 ] [Hong, J.]College of Biological Science and Technology, Fuzhou University, Fuzhou 380108, Fujian, China
  • [ 6 ] [Yan, X.]Life Sciences College, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China
  • [ 7 ] [Lin, D.]Department of Chemistry, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005, Fujian, China
  • [ 8 ] [Lai, R.]Life Sciences College, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China
  • [ 9 ] [Lai, R.]Key Laboratory of Animal Models and Human Disease Mechanisms, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, Yunnan, China

Reprint 's Address:

  • [Yan, X.]Life Sciences College, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China

Show more details

Related Keywords:

Related Article:

Source :

Journal of Medicinal Chemistry

ISSN: 0022-2623

Year: 2013

Issue: 9

Volume: 56

Page: 3546-3556

5 . 4 8

JCR@2013

6 . 9 0 0

JCR@2023

JCR Journal Grade:1

CAS Journal Grade:1

Cited Count:

WoS CC Cited Count:

SCOPUS Cited Count:

ESI Highly Cited Papers on the List: 0 Unfold All

WanFang Cited Count:

Chinese Cited Count:

30 Days PV: 0

Affiliated Colleges:

Online/Total:1253/13885699
Address:FZU Library(No.2 Xuyuan Road, Fuzhou, Fujian, PRC Post Code:350116) Contact Us:0591-22865326
Copyright:FZU Library Technical Support:Beijing Aegean Software Co., Ltd. 闽ICP备05005463号-1