• Complex
  • Title
  • Keyword
  • Abstract
  • Scholars
  • Journal
  • ISSN
  • Conference
成果搜索

author:

Wei, Lin (Wei, Lin.) [1] | Yang, Juanjuan (Yang, Juanjuan.) [2] | He, Xiaoqin (He, Xiaoqin.) [3] | Mo, Guoxiang (Mo, Guoxiang.) [4] | Hong, Jing (Hong, Jing.) [5] (Scholars:洪晶) | Yan, Xiuwen (Yan, Xiuwen.) [6] | Lin, Donghai (Lin, Donghai.) [7] | Lai, Ren (Lai, Ren.) [8]

Indexed by:

Scopus SCIE

Abstract:

Antimicrobial peptides (AMPs) play pivotal roles in the innate defense of vertebrates. A novel AMP (cathelicidin-PY) has been identified from the skin secretions of the frog Paa yunnanensis. Cathelicidin-PY has an amino acid sequence of RKCNFLCICLICEICLRTVITSHIDKVLRPQG. Nuclear magnetic resonance (NMR) spectroscopy analysis revealed that cathelicidin-PY adopts a tertiary structure with a mostly positively charged surface containing a helix (Thr15-Ser19). It possesses strong antimicrobial activity, low hemolytic activity, low cytotoxicity against RAW 264.7 cells, and strong anti-inflammatory activity. The action of antimicrobial activity of cathelicidin-PY is through the destruction of the cell membrane. Moreover, cathelicidin-PY exerts anti-inflammatory activity by inhibiting the production of nitric oxide (NO) and inflammatory cytokines such as tumor necrosis factor (TNF-alpha), interleukin-6 (IL-6), and monocyte chemoattractant protein-1 (MCP-1). Cathelicidin-PY inhibits the activation of Toll-like receptor 4 (TLR4) inflammatory response pathways induced by lipopolysaccharide (LPS). The NMR titration experiments indicated that cathelicidin-PY can bind to LPS. In conclusion, we have identified a novel potent peptide antibiotic with both antimicrobial and anti-inflammatory activities and laid the groundwork for future research and development.

Keyword:

Community:

  • [ 1 ] [Wei, Lin]Nanjing Agr Univ, Life Sci Coll, Nanjing 210095, Jiangsu, Peoples R China
  • [ 2 ] [He, Xiaoqin]Nanjing Agr Univ, Life Sci Coll, Nanjing 210095, Jiangsu, Peoples R China
  • [ 3 ] [Mo, Guoxiang]Nanjing Agr Univ, Life Sci Coll, Nanjing 210095, Jiangsu, Peoples R China
  • [ 4 ] [Yan, Xiuwen]Nanjing Agr Univ, Life Sci Coll, Nanjing 210095, Jiangsu, Peoples R China
  • [ 5 ] [Lai, Ren]Nanjing Agr Univ, Life Sci Coll, Nanjing 210095, Jiangsu, Peoples R China
  • [ 6 ] [Yang, Juanjuan]Xiamen Univ, Coll Chem & Chem Engn, Dept Chem, Key Lab Chem Biol Fujian Prov, Xiamen 361005, Fujian, Peoples R China
  • [ 7 ] [Lin, Donghai]Xiamen Univ, Coll Chem & Chem Engn, Dept Chem, Key Lab Chem Biol Fujian Prov, Xiamen 361005, Fujian, Peoples R China
  • [ 8 ] [Lai, Ren]Chinese Acad Sci, Kunming Inst Zool, Key Lab Anim Models & Human Dis Mech, Kunming 650223, Yunnan, Peoples R China
  • [ 9 ] [Hong, Jing]Fuzhou Univ, Coll Biol Sci & Technol, Fuzhou 380108, Fujian, Peoples R China

Reprint 's Address:

  • [Yan, Xiuwen]Nanjing Agr Univ, Life Sci Coll, Nanjing 210095, Jiangsu, Peoples R China

Show more details

Related Keywords:

Related Article:

Source :

JOURNAL OF MEDICINAL CHEMISTRY

ISSN: 0022-2623

Year: 2013

Issue: 9

Volume: 56

Page: 3546-3556

5 . 4 8

JCR@2013

6 . 9 0 0

JCR@2023

ESI Discipline: CHEMISTRY;

JCR Journal Grade:1

CAS Journal Grade:1

Cited Count:

WoS CC Cited Count: 78

SCOPUS Cited Count: 78

ESI Highly Cited Papers on the List: 0 Unfold All

WanFang Cited Count:

Chinese Cited Count:

30 Days PV: 0

Online/Total:1736/13881864
Address:FZU Library(No.2 Xuyuan Road, Fuzhou, Fujian, PRC Post Code:350116) Contact Us:0591-22865326
Copyright:FZU Library Technical Support:Beijing Aegean Software Co., Ltd. 闽ICP备05005463号-1